BPHL purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
BPHL MaxPab polyclonal antibody. Western Blot analysis of BPHL expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of BPHL expression in transfected 293T cell line (H00000670-T01) by BPHL MaxPab polyclonal antibody.
Lane 1: BPHL transfected lysate(30.14 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human BPHL protein.
Immunogen
BPHL (NP_004323.1, 1 a.a. ~ 274 a.a) full-length human protein.
Sequence
MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (86)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
BPHL MaxPab polyclonal antibody. Western Blot analysis of BPHL expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of BPHL expression in transfected 293T cell line (H00000670-T01) by BPHL MaxPab polyclonal antibody.
Lane 1: BPHL transfected lysate(30.14 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — BPHL
Entrez GeneID
670GeneBank Accession#
NM_004332.1Protein Accession#
NP_004323.1Gene Name
BPHL
Gene Alias
Bph-rp, MCNAA, MGC125930, MGC41865
Gene Description
biphenyl hydrolase-like (serine hydrolase)
Omim ID
603156Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants have been described
Other Designations
OTTHUMP00000015959|biphenyl hydrolase-like|biphenyl hydrolase-like (serine hydrolase; breast epithelial mucin-associated antigen)|breast epithelial mucin-associated antigen|valacyclovirase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com