Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BPHL polyclonal antibody (A01)

  • Catalog # : H00000670-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BPHL.
  • Immunogen:
  • BPHL (NP_004323, 175 a.a. ~ 274 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000670-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 670
  • Gene Name:
  • BPHL
  • Gene Alias:
  • Bph-rp,MCNAA,MGC125930,MGC41865
  • Gene Description:
  • biphenyl hydrolase-like (serine hydrolase)
  • Gene Summary:
  • This gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants have been described
  • Other Designations:
  • OTTHUMP00000015959,biphenyl hydrolase-like,biphenyl hydrolase-like (serine hydrolase; breast epithelial mucin-associated antigen),breast epithelial mucin-associated antigen,valacyclovirase
  • RSS
  • YouTube
  • Linkedin
  • Facebook