Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DST (Human) Recombinant Protein (Q01)

  • Catalog # : H00000667-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DST partial ORF ( NP_899236, 401 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000667-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 667
  • Gene Name:
  • DST
  • Gene Alias:
  • BP240,BPA,BPAG1,CATX-15,D6S1101,DKFZp564B2416,DMH,DT,FLJ46791,KIAA0465,KIAA1470,MACF2
  • Gene Description:
  • dystonin
  • Gene Summary:
  • This gene encodes a member of the plakin protein family of adhesion junction plaque proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the full-length nature of some variants has not been defined. It has been known that some isoforms are expressed in neural and muscle tissue, anchoring neural intermediate filaments to the actin cytoskeleton, and some isoforms are expressed in epithelial tissue, anchoring keratin-containing intermediate filaments to hemidesmosomes. Consistent with the expression, mice defective for this gene show skin blistering and neurodegeneration. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016657,OTTHUMP00000040015,bullous pemphigoid antigen 1, 230/240kDa,dystonia musculorum of mouse, human homolog of,hemidesmosomal plaque protein
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook