DST polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant DST.
Immunogen
DST (NP_899236, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag.
Sequence
EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — DST
Entrez GeneID
667GeneBank Accession#
NM_183380Protein Accession#
NP_899236Gene Name
DST
Gene Alias
BP240, BPA, BPAG1, CATX-15, D6S1101, DKFZp564B2416, DMH, DT, FLJ46791, KIAA0465, KIAA1470, MACF2
Gene Description
dystonin
Omim ID
113810Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the plakin protein family of adhesion junction plaque proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the full-length nature of some variants has not been defined. It has been known that some isoforms are expressed in neural and muscle tissue, anchoring neural intermediate filaments to the actin cytoskeleton, and some isoforms are expressed in epithelial tissue, anchoring keratin-containing intermediate filaments to hemidesmosomes. Consistent with the expression, mice defective for this gene show skin blistering and neurodegeneration. [provided by RefSeq
Other Designations
OTTHUMP00000016657|OTTHUMP00000040015|bullous pemphigoid antigen 1, 230/240kDa|dystonia musculorum of mouse, human homolog of|hemidesmosomal plaque protein
-
Interactome
-
Disease
-
Publication Reference
-
Evaluation of Contraceptive Potential of a Novel Epididymal Sperm Protein SFP2 in a Mouse Model.
Khan SA, Jadhav SV, Suryawanshi AR, Bhonde GS, Gajbhiye RK, Khole VV.
American Journal of Reproductive Immunology 2011 Sep; 66(3):185.
Application:IF, Human, Mouse, Rat, Sperm.
-
Evaluation of Contraceptive Potential of a Novel Epididymal Sperm Protein SFP2 in a Mouse Model.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com