BNIP3L monoclonal antibody (M01), clone 3G2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BNIP3L.
Immunogen
BNIP3L (NP_004322, 43 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BNIP3L is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to BNIP3L on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — BNIP3L
Entrez GeneID
665GeneBank Accession#
NM_004331Protein Accession#
NP_004322Gene Name
BNIP3L
Gene Alias
BNIP3a, NIX
Gene Description
BCL2/adenovirus E1B 19kDa interacting protein 3-like
Omim ID
605368Gene Ontology
HyperlinkGene Summary
This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. The protein encoded by this gene is a functional homolog of BNIP3, a proapoptotic protein. This protein may function simultaneously with BNIP3 and may play a role in tumor suppression. [provided by RefSeq
Other Designations
BCL2/adenovirus E1B 19-kd protein-interacting protein 3a|BCL2/adenovirus E1B 19kD-interacting protein 3-like|adenovirus E1B19k-binding protein B5
-
Interactome
-
Disease
-
Publication Reference
-
p53/Mieap-regulated mitochondrial quality control plays an important role as a tumor suppressor in gastric and esophageal cancers.
Hitoya Sano, Manabu Futamura, Siqin Gaowa, Hiroki Kamino, Yasuyuki Nakamura, Kazuya Yamaguchi, Yoshihiro Tanaka, Itaru Yasufuku, Akira Nakakami, Hirofumi Arakawa, Kazuhiro Yoshida.
Biochemical and Biophysical Research Communications 2020 Aug; 11(1):4116.
Application:WB-Tr, Human, MKN1, MKN45, TMK1 cells.
-
Possible role of p53/Mieap-regulated mitochondrial quality control as a tumor suppressor in human breast cancer.
Siqin Gaowa, Manabu Futamura, Masayuki Tsuneki, Hiroki Kamino, Jesse Y Tajima, Ryutaro Mori, Hirofumi Arakawa, Kazuhiro Yoshida.
Cancer Science 2018 Dec; 109(12):3910.
Application:WB-Tr, Human, MCF-7, MDA-MB-231, SK-BR-3 cells.
-
Identification of 14-3-3γ as a Mieap-interacting protein and its role in mitochondrial quality control.
Miyamoto T, Kitamura N, Ono M, Nakamura Y, Yoshida M, Kamino H, Murai R, Yamada T, Arakawa H.
Scientific Reports 2012 Apr; 2:379.
Application:WB-Ce, Human, A-549, HCT-116 cells.
-
BNIP3 and NIX mediate Mieap-induced accumulation of lysosomal proteins within mitochondria.
Nakamura Y, Kitamura N, Shinogi D, Yoshida M, Goda O, Murai R, Kamino H, Arakawa H.
PLoS One 2012 Jan; 7(1):e30767.
Application:IP-WB, WB-Ce, Human, A-549.
-
p53/Mieap-regulated mitochondrial quality control plays an important role as a tumor suppressor in gastric and esophageal cancers.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com