BNIP3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of BNIP3 expression in transfected 293T cell line (H00000664-T05) by BNIP3 MaxPab polyclonal antibody.
Lane 1: BNIP3 transfected lysate(21.50 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human BNIP3 protein.
Immunogen
BNIP3 (NP_004043.2, 1 a.a. ~ 194 a.a) full-length human protein.
Sequence
MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BNIP3 expression in transfected 293T cell line (H00000664-T05) by BNIP3 MaxPab polyclonal antibody.
Lane 1: BNIP3 transfected lysate(21.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — BNIP3
Entrez GeneID
664GeneBank Accession#
NM_004052Protein Accession#
NP_004043.2Gene Name
BNIP3
Gene Alias
NIP3
Gene Description
BCL2/adenovirus E1B 19kDa interacting protein 3
Omim ID
603293Gene Ontology
HyperlinkGene Summary
This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. This gene contains a BH3 domain and a transmembrane domain, which have been associated with pro-apoptotic function. The dimeric mitochondrial protein encoded by this gene is known to induce apoptosis, even in the presence of BCL2. [provided by RefSeq
Other Designations
BCL2/adenovirus E1B 19kD-interacting protein 3|OTTHUMP00000020752
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com