BNIP2 monoclonal antibody (M02), clone 8C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
BNIP2 monoclonal antibody (M02), clone 8C6. Western Blot analysis of BNIP2 expression in K-562.
Western Blot (Transfected lysate)
Western Blot analysis of BNIP2 expression in transfected 293T cell line by BNIP2 monoclonal antibody (M02), clone 8C6.
Lane 1: BNIP2 transfected lysate (Predicted MW: 36 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BNIP2 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (60.28 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant BNIP2.
Immunogen
BNIP2 (AAH02461, 1 a.a. ~ 314 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (60.28 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BNIP2 monoclonal antibody (M02), clone 8C6. Western Blot analysis of BNIP2 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of BNIP2 expression in transfected 293T cell line by BNIP2 monoclonal antibody (M02), clone 8C6.
Lane 1: BNIP2 transfected lysate (Predicted MW: 36 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BNIP2 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — BNIP2
Entrez GeneID
663GeneBank Accession#
BC002461Protein Accession#
AAH02461Gene Name
BNIP2
Gene Alias
BNIP-2, NIP2
Gene Description
BCL2/adenovirus E1B 19kDa interacting protein 2
Omim ID
603292Gene Ontology
HyperlinkGene Summary
This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. Though the specific function is unknown, it interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. [provided by RefSeq
Other Designations
BCL2/adenovirus E1B 19kD interacting protein 2|BCL2/adenovirus E1B 19kD-interacting protein 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com