POLR3D purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
POLR3D MaxPab polyclonal antibody. Western Blot analysis of POLR3D expression in Hela S3 NE.
Western Blot (Cell lysate)
POLR3D MaxPab polyclonal antibody. Western Blot analysis of POLR3D expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of POLR3D expression in transfected 293T cell line (H00000661-T03) by POLR3D MaxPab polyclonal antibody.
Lane 1: POLR3D transfected lysate(43.78 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human POLR3D protein.
Immunogen
POLR3D (NP_001713.2, 1 a.a. ~ 398 a.a) full-length human protein.
Sequence
MSEGNAAGEPSTPGGPRPLLTGARGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNMPVQLPLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRDEEEEAKMKAPPKAARKTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
POLR3D MaxPab polyclonal antibody. Western Blot analysis of POLR3D expression in Hela S3 NE.Western Blot (Cell lysate)
POLR3D MaxPab polyclonal antibody. Western Blot analysis of POLR3D expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of POLR3D expression in transfected 293T cell line (H00000661-T03) by POLR3D MaxPab polyclonal antibody.
Lane 1: POLR3D transfected lysate(43.78 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — POLR3D
Entrez GeneID
661GeneBank Accession#
NM_001722.2Protein Accession#
NP_001713.2Gene Name
POLR3D
Gene Alias
BN51T, RPC4, RPC53, TSBN51
Gene Description
polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
Omim ID
187280Gene Ontology
HyperlinkGene Summary
This gene complements a temperature-sensitive mutant isolated from the BHK-21 Syrian hamster cell line. It leads to a block in progression through the G1 phase of the cell cycle at nonpermissive temperatures. [provided by RefSeq
Other Designations
BN51 (BHK21) temperature sensitivity complementing|polymerase (RNA) III (DNA directed) polypeptide D|temperature sensitive complementation, cell cycle specific, tsBN51
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com