BMPR1B monoclonal antibody (M07), clone 2E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BMPR1B.
Immunogen
BMPR1B (AAH47773.1, 24 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVDGPIHHRA
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BMPR1B is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — BMPR1B
Entrez GeneID
658GeneBank Accession#
BC047773Protein Accession#
AAH47773.1Gene Name
BMPR1B
Gene Alias
ALK-6, ALK6, CDw293
Gene Description
bone morphogenetic protein receptor, type IB
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. The ligands of this receptor are BMPs, which are members of the TGF-beta superfamily. BMPs are involved in endochondral bone formation and embryogenesis. These proteins transduce their signals through the formation of heteromeric complexes of 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. Mutations in this gene have been associated with primary pulmonary hypertension. [provided by RefSeq
Other Designations
OTTHUMP00000161622|activin receptor-like kinase 6|serine/threonine receptor kinase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com