Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BMP8B (Human) Recombinant Protein (Q01)

  • Catalog # : H00000656-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BMP8B partial ORF ( NP_001711, 274 a.a. - 362 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000656-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 656
  • Gene Name:
  • BMP8B
  • Gene Alias:
  • BMP8,MGC131757,OP2
  • Gene Description:
  • bone morphogenetic protein 8b
  • Gene Summary:
  • The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has led to speculation of possible bone inductive activity. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000010836,bone morphogenetic protein 8 (osteogenic protein 2),bone morphogenetic protein 8B,dJ118J21.1 (bone morphogenetic protein 8 (osteogenic protein 2)),osteogenic protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook