BMP8B monoclonal antibody (M01A), clone 6D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BMP8B.
Immunogen
BMP8B (NP_001711, 274 a.a. ~ 362 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAV
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — BMP8B
Entrez GeneID
656GeneBank Accession#
NM_001720Protein Accession#
NP_001711Gene Name
BMP8B
Gene Alias
BMP8, MGC131757, OP2
Gene Description
bone morphogenetic protein 8b
Omim ID
602284Gene Ontology
HyperlinkGene Summary
The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has led to speculation of possible bone inductive activity. [provided by RefSeq
Other Designations
OTTHUMP00000010836|bone morphogenetic protein 8 (osteogenic protein 2)|bone morphogenetic protein 8B|dJ118J21.1 (bone morphogenetic protein 8 (osteogenic protein 2))|osteogenic protein 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Gene expression of bone morphogenic protein 8B in the primary site, peripheral blood and bone marrow of patients with gastric cancer.
Mima K, Fukagawa T, Kurashige J, Takano Y, Uchi R, Ueo H, Matsumura T, Ishibashi M, Sawada G, Takahashi Y, Akiyoshi S, Eguchi H, Sudo T, Sugimachi K, Watanabe M, Ishii H, Mori M, Baba H, Sasako M, Mimori K.
Oncology Letters 2013 Aug; 6(2):387.
Application：IHC-P, Human, Human gastric cancer.
-
Gene expression of bone morphogenic protein 8B in the primary site, peripheral blood and bone marrow of patients with gastric cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com