Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BMP1 polyclonal antibody (A01)

  • Catalog # : H00000649-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BMP1.
  • Immunogen:
  • BMP1 (NP_006120, 747 a.a. ~ 845 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • CDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLRFYSDN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000649-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • BMP1 polyclonal antibody (A01), Lot # 051012JC01 Western Blot analysis of BMP1 expression in HL-60 ( Cat # L014V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 649
  • Gene Name:
  • BMP1
  • Gene Alias:
  • FLJ44432,PCOLC,PCP,TLD,pCP-2
  • Gene Description:
  • bone morphogenetic protein 1
  • Gene Summary:
  • This gene encodes a protein that is capable of inducing formation of cartilage in vivo. Although other bone morphogenetic proteins are members of the TGF-beta superfamily, this gene encodes a protein that is not closely related to other known growth factors. This gene is expressed as alternatively spliced variants that share an N-terminal protease domain but differ in their C-terminal region. [provided by RefSeq
  • Other Designations:
  • procollagen C-endopeptidase,procollagen C-proteinase
  • RSS
  • YouTube
  • Linkedin
  • Facebook