BLVRB monoclonal antibody (M09), clone 2F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of BLVRB expression in transfected 293T cell line by BLVRB monoclonal antibody (M09), clone 2F4.
Lane 1: BLVRB transfected lysate(22.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BLVRB is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BLVRB.
Immunogen
BLVRB (NP_000704, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BLVRB expression in transfected 293T cell line by BLVRB monoclonal antibody (M09), clone 2F4.
Lane 1: BLVRB transfected lysate(22.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BLVRB is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — BLVRB
Entrez GeneID
645GeneBank Accession#
NM_000713Protein Accession#
NP_000704Gene Name
BLVRB
Gene Alias
BVRB, FLR, MGC117413, SDR43U1
Gene Description
biliverdin reductase B (flavin reductase (NADPH))
Omim ID
600941Gene Ontology
HyperlinkGene Summary
The final step in heme metabolism in mammals is catalyzed by the cytosolic biliverdin reductase enzymes A and B (EC 1.3.1.24).[supplied by OMIM
Other Designations
flavin reductase (NADPH)|short chain dehydrogenase/reductase family 43U, member 1
-
Interactome
-
Pathway
-
Publication Reference
-
The heme degradation pathway is a promising serum biomarker source for the early detection of Alzheimer's disease.
Mueller C, Zhou W, Vanmeter A, Heiby M, Magaki S, Ross MM, Espina V, Schrag M, Dickson C, Liotta LA, Kirsch WM.
Journal of Alzheimer's Disease 2010 Jan; 19(3):1081.
Application：Func, Human, Serum.
-
The heme degradation pathway is a promising serum biomarker source for the early detection of Alzheimer's disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com