BID purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human BID protein.
Immunogen
BID (NP_001187.1, 1 a.a. ~ 195 a.a) full-length human protein.
Sequence
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BID MaxPab rabbit polyclonal antibody. Western Blot analysis of BID expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of BID expression in transfected 293T cell line (H00000637-T01) by BID MaxPab polyclonal antibody.
Lane 1: BID transfected lysate(22.00 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between BID and BAX. HeLa cells were stained with anti-BID rabbit purified polyclonal 1:1200 and anti-BAX mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — BID
Entrez GeneID
637GeneBank Accession#
NM_001196Protein Accession#
NP_001187.1Gene Name
BID
Gene Alias
FP497, MGC15319, MGC42355
Gene Description
BH3 interacting domain death agonist
Omim ID
601997Gene Ontology
HyperlinkGene Summary
This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been defined. [provided by RefSeq
Other Designations
BH3-interacting domain death agonist|BID isoform ES(1b)|BID isoform L(2)|BID isoform Si6|Human BID coding sequence|OTTHUMP00000196197|apoptic death agonist|desmocollin type 4
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com