Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BICD1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000636-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BICD1 partial ORF ( NP_001705, 1 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAAEEVLQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDSLKQELEQLK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.44
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000636-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 636
  • Gene Name:
  • BICD1
  • Gene Alias:
  • BICD
  • Gene Description:
  • bicaudal D homolog 1 (Drosophila)
  • Gene Summary:
  • This gene is one of two human homologs of Drosophila bicaudal-D. It has been implicated in COPI-independent membrane transport from the Golgi apparatus to the endoplasmic reticulum. Two alternative splice variants have been described. Other alternative splice variants that encode different protein isoforms have been described but their full-length nature has not been determined. [provided by RefSeq
  • Other Designations:
  • bicaudal D homolog 1,cytoskeleton-like bicaudal D protein homolog 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook