Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BICD1 polyclonal antibody (A01)

  • Catalog # : H00000636-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BICD1.
  • Immunogen:
  • BICD1 (NP_001705, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MAAEEVLQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDSLKQELEQLK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000636-A01
    Western Blot detection against Immunogen (33.81 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 636
  • Gene Name:
  • BICD1
  • Gene Alias:
  • BICD
  • Gene Description:
  • bicaudal D homolog 1 (Drosophila)
  • Gene Summary:
  • This gene is one of two human homologs of Drosophila bicaudal-D. It has been implicated in COPI-independent membrane transport from the Golgi apparatus to the endoplasmic reticulum. Two alternative splice variants have been described. Other alternative splice variants that encode different protein isoforms have been described but their full-length nature has not been determined. [provided by RefSeq
  • Other Designations:
  • bicaudal D homolog 1,cytoskeleton-like bicaudal D protein homolog 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook