Product Browser

Last updated: 2017/8/13
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BGLAP polyclonal antibody (A01)

  • Catalog # : H00000632-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BGLAP.
  • Immunogen:
  • BGLAP (NP_954642, 52 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000632-A01
    Western Blot detection against Immunogen (31.5 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 632
  • Gene Name:
  • BGLAP
  • Gene Alias:
  • BGP,OC,PMF1
  • Gene Description:
  • bone gamma-carboxyglutamate (gla) protein
  • Other Designations:
  • OTTHUMP00000016586,bone Gla protein,bone gamma-carboxyglutamate (gla) protein (osteocalcin),gamma-carboxyglutamic acid-containing protein,osteocalcin
  • RSS
  • YouTube
  • Linkedin
  • Facebook