Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BCS1L (Human) Recombinant Protein (Q01)

  • Catalog # : H00000617-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BCS1L partial ORF ( NP_004319, 320 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ASTEARIVFMTTNHVDRLDPALIRPGRVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAESLR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000617-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 617
  • Gene Name:
  • BCS1L
  • Gene Alias:
  • BCS,BCS1,BJS,FLNMS,GRACILE,Hs.6719,PTD,h-BCS
  • Gene Description:
  • BCS1-like (yeast)
  • Gene Summary:
  • This gene encodes a homolog of the S. cerevisiae bcs1 protein which is involved in the assembly of complex III of the mitochondrial respiratory chain. The encoded protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Two alternatively spliced transcripts encoding the same protein have been described. [provided by RefSeq
  • Other Designations:
  • BCS1-like,BCS1-like protein,OTTHUMP00000164147,mitochondrial chaperone BCS1,mitochondrial complex III assembly
  • RSS
  • YouTube
  • Linkedin
  • Facebook