BCL2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human BCL2 full-length ORF ( AAH27258.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
52.7
Interspecies Antigen Sequence
Mouse (90)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — BCL2
Entrez GeneID
596GeneBank Accession#
BC027258.1Protein Accession#
AAH27258.1Gene Name
BCL2
Gene Alias
Bcl-2
Gene Description
B-cell CLL/lymphoma 2
Omim ID
151430Gene Ontology
HyperlinkGene Summary
This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Two transcript variants, produced by alternate splicing, differ in their C-terminal ends. [provided by RefSeq
Other Designations
B-cell lymphoma protein 2|OTTHUMP00000163680
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Threonine 56 phosphorylation of Bcl-2 is required for LRRK2 G2019S-induced mitochondrial depolarization and autophagy.
Su YC, Guo X, Qi X.
Biochimica et Biophysica Acta 2015 Jan; 1852(1):12.
Application:WB-Ce, WB-Tr, Human, Fibroblasts, HeLa cells.
-
Threonine 56 phosphorylation of Bcl-2 is required for LRRK2 G2019S-induced mitochondrial depolarization and autophagy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com