BAX (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human BAX partial ORF ( NP_620116, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — BAX
Entrez GeneID
581GeneBank Accession#
NM_138761Protein Accession#
NP_620116Gene Name
BAX
Gene Alias
BCL2L4
Gene Description
BCL2-associated X protein
Omim ID
600040Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene. [provided by RefSeq
Other Designations
apoptosis regulator BAX
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Drp1 Mediates Caspase-Independent Type III Cell Death in Normal and Leukemic Cells.
Bras M, Yuste VJ, Roue G, Barbier S, Sancho P, Virely C, Rubio M, Baudet S, Esquerda JE, Merle-Beral H, Sarfati M, Susin SA.
Molecular and Cellular Biology 2007 Aug; 27(20):7073.
Application:WB, Human, Jurkat cells .
-
Drp1 Mediates Caspase-Independent Type III Cell Death in Normal and Leukemic Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com