BAG1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human BAG1 partial ORF ( NP_004314, 241 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.29
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — BAG1
Entrez GeneID
573GeneBank Accession#
NM_004323Protein Accession#
NP_004314Gene Name
BAG1
Gene Alias
RAP46
Gene Description
BCL2-associated athanogene
Omim ID
601497Gene Ontology
HyperlinkGene Summary
The oncogene BCL2 is a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to BCL2 and is referred to as BCL2-associated athanogene. It enhances the anti-apoptotic effects of BCL2 and represents a link between growth factor receptors and anti-apoptotic mechanisms. At least three protein isoforms are encoded by this mRNA through the use of a non-AUG (CUG) start site, and alternative, downstream, AUG translation initiation sites. [provided by RefSeq
Other Designations
BCL2-associated athanogene 1
-
Interactome
-
Disease
-
Publication Reference
-
Co-chaperone potentiation of vitamin D receptor-mediated transactivation: a role for Bcl2-associated athanogene-1 as an intracellular-binding protein for 1,25-dihydroxyvitamin D3.
Chun RF, Gacad M, Nguyen L, Hewison M, Adams JS.
Journal of Molecular Endocrinology 2007 Aug; 39(2):81.
Application:Func, Vitamin D metabolites.
-
Co-chaperone potentiation of vitamin D receptor-mediated transactivation: a role for Bcl2-associated athanogene-1 as an intracellular-binding protein for 1,25-dihydroxyvitamin D3.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com