BACH1 monoclonal antibody (M02), clone 1B8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
BACH1 monoclonal antibody (M02), clone 1B8 Western Blot analysis of BACH1 expression in NIH/3T3 ( Cat # L018V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BACH1 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BACH1.
Immunogen
BACH1 (NP_996749, 396 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HLAKGFWSDICSTDTPCQMQLSPAVAKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPC
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BACH1 monoclonal antibody (M02), clone 1B8 Western Blot analysis of BACH1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BACH1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — BACH1
Entrez GeneID
571GeneBank Accession#
NM_206866Protein Accession#
NP_996749Gene Name
BACH1
Gene Alias
-
Gene Description
BTB and CNC homology 1, basic leucine zipper transcription factor 1
Omim ID
602751Gene Ontology
HyperlinkGene Summary
This gene encodes a transcription factor that belongs to the cap'n'collar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq
Other Designations
BTB and CNC homology 1|OTTHUMP00000096564
-
Interactome
-
Disease
-
Publication Reference
-
RANKL induces Bach1 nuclear import and attenuates Nrf2-mediated antioxidant enzymes, thereby augmenting intracellular reactive oxygen species signaling and osteoclastogenesis in mice.
Kanzaki H, Shinohara F, Itohiya K, Yamaguchi Y, Katsumata Y, Matsuzawa M, Fukaya S,Miyamoto Y, Wada S, Nakamura Y.
FASEB Journal 2017 Feb; 31(2):781.
Application：IF, WB, Mouse, Raw 264.7 cells.
-
RANKL induces Bach1 nuclear import and attenuates Nrf2-mediated antioxidant enzymes, thereby augmenting intracellular reactive oxygen species signaling and osteoclastogenesis in mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com