Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BAAT (Human) Recombinant Protein (Q01)

  • Catalog # : H00000570-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BAAT partial ORF ( NP_001692, 258 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.52
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000570-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 570
  • Gene Name:
  • BAAT
  • Gene Alias:
  • BACAT,BAT,FLJ20300,MGC104432
  • Gene Description:
  • bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase)
  • Gene Summary:
  • The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000021802,bile acid Coenzyme A: amino acid N-acyltransferase,glycine N-choloyltransferase
  • RSS
  • YouTube
  • Linkedin
  • Facebook