BAAT monoclonal antibody (M02), clone 5B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
BAAT monoclonal antibody (M02), clone 5B6 Western Blot analysis of BAAT expression in HepG2 ( Cat # L019V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BAAT is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BAAT.
Immunogen
BAAT (NP_001692, 258 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (58); Rat (59)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BAAT monoclonal antibody (M02), clone 5B6 Western Blot analysis of BAAT expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BAAT is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — BAAT
Entrez GeneID
570GeneBank Accession#
NM_001701Protein Accession#
NP_001692Gene Name
BAAT
Gene Alias
BACAT, BAT, FLJ20300, MGC104432
Gene Description
bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000021802|bile acid Coenzyme A: amino acid N-acyltransferase|glycine N-choloyltransferase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com