Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AVPR1B (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00000553-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AVPR1B full-length ORF (AAI56079.1) recombinant protein without tag.
  • Sequence:
  • MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 46.7
  • Form:
  • Liquid
  • Recommend Usage:
  • Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 553
  • Gene Name:
  • AVPR1B
  • Gene Alias:
  • AVPR3
  • Gene Description:
  • arginine vasopressin receptor 1B
  • Gene Summary:
  • The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1A, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor is primarily located in the anterior pituitary, where it stimulates ACTH release. It is expressed at high levels in ACTH-secreting pituitary adenomas as well as in bronchial carcinoids responsible for the ectopic ACTH syndrome. A spliced antisense transcript of this gene has been reported but its function is not known. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000034344,antidiuretic hormone receptor 1B,arginine vasopressin receptor 3,pituitary vasopressin receptor 3,vasopressin V1B receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook