ATP7B monoclonal antibody (M01), clone 3E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ATP7B monoclonal antibody (M01), clone 3E10. Western Blot analysis of ATP7B expression in human colon.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATP7B is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.08 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ATP7B.
Immunogen
ATP7B (NP_000044, 1372 a.a. ~ 1465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (84)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ATP7B monoclonal antibody (M01), clone 3E10. Western Blot analysis of ATP7B expression in human colon.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATP7B is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — ATP7B
Entrez GeneID
540GeneBank Accession#
NM_000053Protein Accession#
NP_000044Gene Name
ATP7B
Gene Alias
PWD, WC1, WD, WND
Gene Description
ATPase, Cu++ transporting, beta polypeptide
Gene Ontology
HyperlinkGene Summary
This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease (WD). [provided by RefSeq
Other Designations
ATPase, Cu(2+)- transporting, beta polypeptide|OTTHUMP00000040880|Wilson disease-associated protein|copper pump 2|copper-transporting ATPase 2
-
Interactome
-
Disease
-
Publication Reference
-
Characterization of Sandwich-Cultured Hepatocytes as an In Vitro Model to Assess the Hepatobiliary Disposition of Copper.
Ansede JH, Wright MR, St Claire RL, Hart RW, Gefroh HA, Brouwer KR.
Drug Metabolism and Disposition 2009 May; 37(5):969.
Application：WB, Rat, dog, human, Hepatocytes.
-
Characterization of Sandwich-Cultured Hepatocytes as an In Vitro Model to Assess the Hepatobiliary Disposition of Copper.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com