Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP7A (Human) Recombinant Protein (Q01)

  • Catalog # : H00000538-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ATP7A partial ORF ( NP_000043, 1406 a.a. - 1500 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • FLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTAL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.19
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000538-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 538
  • Gene Name:
  • ATP7A
  • Gene Alias:
  • FLJ17790,MK,MNK
  • Gene Description:
  • ATPase, Cu++ transporting, alpha polypeptide
  • Gene Summary:
  • This gene encodes a transmembrane protein that functions in copper transport across membranes. The protein localizes to the trans-Golgi network, where it is predicted to supply copper to copper-dependent enzymes in the secretory pathway. The protein relocalizes to the plasma membrane under conditions of elevated extracellular copper and functions in the efflux of copper from cells. Mutations in this gene result in Menkes disease, X-linked cutis laxa, and occipital horn syndrome. [provided by RefSeq
  • Other Designations:
  • Cu++-transporting P-type ATPase,Menkes disease-associated protein,Menkes syndrome,OTTHUMP00000023593,OTTHUMP00000062077,copper pump 1,copper-transporting ATPase 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook