ATP7A (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ATP7A partial ORF ( NP_000043, 1406 a.a. - 1500 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
FLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTAL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.19
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ATP7A
Entrez GeneID
538GeneBank Accession#
NM_000052Protein Accession#
NP_000043Gene Name
ATP7A
Gene Alias
FLJ17790, MK, MNK
Gene Description
ATPase, Cu++ transporting, alpha polypeptide
Gene Ontology
HyperlinkGene Summary
This gene encodes a transmembrane protein that functions in copper transport across membranes. The protein localizes to the trans-Golgi network, where it is predicted to supply copper to copper-dependent enzymes in the secretory pathway. The protein relocalizes to the plasma membrane under conditions of elevated extracellular copper and functions in the efflux of copper from cells. Mutations in this gene result in Menkes disease, X-linked cutis laxa, and occipital horn syndrome. [provided by RefSeq
Other Designations
Cu++-transporting P-type ATPase|Menkes disease-associated protein|Menkes syndrome|OTTHUMP00000023593|OTTHUMP00000062077|copper pump 1|copper-transporting ATPase 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com