ATP6V1E1 monoclonal antibody (M02), clone 4E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant ATP6V1E1.
Immunogen
ATP6V1E1 (AAH04443, 1 a.a. ~ 226 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (50.6 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ATP6V1E1 expression in transfected 293T cell line by ATP6V1E1 monoclonal antibody (M02), clone 4E11.
Lane 1: ATP6V1E1 transfected lysate(26.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATP6V1E1 is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ATP6V1E1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — ATP6V1E1
Entrez GeneID
529GeneBank Accession#
BC004443Protein Accession#
AAH04443Gene Name
ATP6V1E1
Gene Alias
ATP6E, ATP6E2, ATP6V1E, P31, Vma4
Gene Description
ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1
Omim ID
108746Gene Ontology
HyperlinkGene Summary
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome. [provided by RefSeq
Other Designations
ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD|H(+)-transporting two-sector ATPase, 31kDa subunit|H+-transporting ATP synthase chain E, vacuolar|V-ATPase, subunit E|vacuolar H+ ATPase E1
-
Interactome
-
Pathway
-
Publication Reference
-
Atg5 Disassociates the V1V0-ATPase to Promote Exosome Production and Tumor Metastasis Independent of Canonical Macroautophagy.
Guo H, Chitiprolu M, Roncevic L, Javalet C, Hemming FJ, Trung MT, Meng L, Latreille E, Tanese de Souza C, McCulloch D, Baldwin RM, Auer R, Côté J, Russell RC, Sadoul R, Gibbings D.
Developmental Cell 2017 Dec; 43(6):716.
Application:PLA, Mouse, MEF cells.
-
Atg5 Disassociates the V1V0-ATPase to Promote Exosome Production and Tumor Metastasis Independent of Canonical Macroautophagy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com