Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP6V1E1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000529-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human ATP6V1E1 protein.
  • Immunogen:
  • ATP6V1E1 (NP_001687.1, 1 a.a. ~ 226 a.a) full-length human protein.
  • Sequence:
  • MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ATP6V1E1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP6V1E1 expression in human kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ATP6V1E1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP6V1E1 expression in mouse lung.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ATP6V1E1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP6V1E1 expression in Jurkat.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ATP6V1E1 expression in transfected 293T cell line (H00000529-T04) by ATP6V1E1 MaxPab polyclonal antibody.

    Lane 1: ATP6V1E1 transfected lysate(26.10 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 529
  • Gene Name:
  • ATP6V1E1
  • Gene Alias:
  • ATP6E,ATP6E2,ATP6V1E,P31,Vma4
  • Gene Description:
  • ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1
  • Gene Summary:
  • This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome. [provided by RefSeq
  • Other Designations:
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD,H(+)-transporting two-sector ATPase, 31kDa subunit,H+-transporting ATP synthase chain E, vacuolar,V-ATPase, subunit E,vacuolar H+ ATPase E1
  • RSS
  • YouTube
  • Linkedin
  • Facebook