ATP6V1C1 mouse monoclonal antibody (hybridoma)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant ATP6V1C1.
Immunogen
ATP6V1C1 (NP_001686.1, 1 a.a. ~ 382 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactivity and specificity confirmed by ELISA and Western Blot.
Deliverables
Up to 5 positive hybridoma clones will be delivered to customer in the cryotube format.
Note
Customer should check the viability of the hybridomas within one month from the date of receipt. Fee-for-service of long term hybridoma storage can be performed upon customer's request.
-
Applications
Western Blot (Transfected lysate)
Western Blot (Recombinant protein)
ELISA
-
Gene Info — ATP6V1C1
Entrez GeneID
528GeneBank Accession#
NM_001695.3Protein Accession#
NP_001686.1Gene Name
ATP6V1C1
Gene Alias
ATP6C, ATP6D, FLJ20057, VATC, Vma5
Gene Description
ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1
Omim ID
603097Gene Ontology
HyperlinkGene Summary
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D. [provided by RefSeq
Other Designations
ATPase, H+ transporting, lysosomal (vacuolar proton pump) 42kD|ATPase, H+ transporting, lysosomal 42kD, V1 subunit C, isoform 1|ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C, isoform 1|H(+)-transporting two-sector ATPase, subunit C|H+ -ATPase C s
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com