ATP6V1C1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant ATP6V1C1.
Immunogen
ATP6V1C1 (NP_001686, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Sequence
MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMA
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ATP6V1C1 polyclonal antibody (A01), Lot # 050914JC01. Western Blot analysis of ATP6V1C1 expression in human ovarian cancer.ELISA
-
Gene Info — ATP6V1C1
Entrez GeneID
528GeneBank Accession#
NM_001695Protein Accession#
NP_001686Gene Name
ATP6V1C1
Gene Alias
ATP6C, ATP6D, FLJ20057, VATC, Vma5
Gene Description
ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1
Omim ID
603097Gene Ontology
HyperlinkGene Summary
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D. [provided by RefSeq
Other Designations
ATPase, H+ transporting, lysosomal (vacuolar proton pump) 42kD|ATPase, H+ transporting, lysosomal 42kD, V1 subunit C, isoform 1|ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C, isoform 1|H(+)-transporting two-sector ATPase, subunit C|H+ -ATPase C s
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com