Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP5J (Human) Recombinant Protein (P02)

  • Catalog # : H00000522-P02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ATP5J full-length ORF ( NP_001003696.1, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 39
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000522-P02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 522
  • Gene Name:
  • ATP5J
  • Gene Alias:
  • ATP5,ATP5A,ATPM,CF6,F6
  • Gene Description:
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6
  • Gene Summary:
  • Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the F6 subunit of the F0 complex, required for F1 and F0 interactions. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000096107,OTTHUMP00000096108,OTTHUMP00000096110,OTTHUMP00000096111,OTTHUMP00000096112,mitochondrial ATP synthase, coupling factor 6,mitochondrial ATP synthase, subunit F6,mitochondrial ATPase coupling factor 6,proliferation-inducing protein 36
  • RSS
  • YouTube
  • Linkedin
  • Facebook