Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP5G3 (Human) Recombinant Protein (P01)

  • Catalog # : H00000518-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ATP5G3 full-length ORF ( NP_001002258.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 41.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000518-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 518
  • Gene Name:
  • ATP5G3
  • Gene Alias:
  • MGC125738,P3
  • Gene Description:
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9)
  • Gene Summary:
  • This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq
  • Other Designations:
  • ATP synthase lipid-binding protein, mitochondrial,ATP synthase proteolipid P3,ATP synthase subunit 9,ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3,ATP synthase, mitochondrial, C subunit-3,ATPase protein 9,ATPase subunit C
  • RSS
  • YouTube
  • Linkedin
  • Facebook