ATP5G3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ATP5G3 full-length ORF ( NP_001002258.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
41.1
Interspecies Antigen Sequence
Mouse (95)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ATP5G3
Entrez GeneID
518GeneBank Accession#
NM_001002258.2Protein Accession#
NP_001002258.1Gene Name
ATP5G3
Gene Alias
MGC125738, P3
Gene Description
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9)
Omim ID
602736Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq
Other Designations
ATP synthase lipid-binding protein, mitochondrial|ATP synthase proteolipid P3|ATP synthase subunit 9|ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3|ATP synthase, mitochondrial, C subunit-3|ATPase protein 9|ATPase subunit C
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com