Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP5G2 (Human) Recombinant Protein (P01)

  • Catalog # : H00000517-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ATP5G2 full-length ORF ( AAH20826, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 41.25
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000517-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 517
  • Gene Name:
  • ATP5G2
  • Gene Alias:
  • -
  • Gene Description:
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9)
  • Gene Summary:
  • This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and single representatives of the gamma, delta, and epsilon subunits. The proton channel likely has nine subunits (a, b, c, d, e, f, g, F6 and 8). There are three separate genes which encode subunit c of the proton channel and they specify precursors with different import sequences but identical mature proteins. The protein encoded by this gene is one of three precursors of subunit c. Alternatively spliced transcript variants encoding different isoforms have been identified. This gene has multiple pseudogenes. [provided by RefSeq
  • Other Designations:
  • ATP synthase lipid-binding protein, mitochondrial,ATP synthase proteolipid P2,ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2,ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2,ATPase protein 9,AT
  • RSS
  • YouTube
  • Linkedin
  • Facebook