Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP5G1 monoclonal antibody (M01), clone 1A12

  • Catalog # : H00000516-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant ATP5G1.
  • Immunogen:
  • ATP5G1 (AAH04963, 18 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • TRGLIRPVSASFLSSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000516-M01
    Western Blot detection against Immunogen (38.83 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged ATP5G1 is approximately 3ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 516
  • Gene Name:
  • ATP5G1
  • Gene Alias:
  • ATP5A,ATP5G
  • Gene Description:
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9)
  • Gene Summary:
  • This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq
  • Other Designations:
  • ATP synthase lipid-binding protein, mitochondrial,ATP synthase proteolipid P1,ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1,ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1,ATPase protein 9,AT
  • RSS
  • YouTube
  • Linkedin
  • Facebook