ATP5F1 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ATP5F1 protein.
Immunogen
ATP5F1 (NP_001679.2, 1 a.a. ~ 256 a.a) full-length human protein.
Sequence
MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ATP5F1 expression in transfected 293T cell line (H00000515-T02) by ATP5F1 MaxPab polyclonal antibody.
Lane 1: ATP5F1 transfected lysate(28.16 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ATP5F1
Entrez GeneID
515GeneBank Accession#
NM_001688.4Protein Accession#
NP_001679.2Gene Name
ATP5F1
Gene Alias
MGC24431, PIG47
Gene Description
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
Omim ID
603270Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel. [provided by RefSeq
Other Designations
ATP synthase B chain, mitochondrial|ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1|H+-ATP synthase subunit b|OTTHUMP00000013469|cell proliferation-inducing protein 47
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com