ATP5E (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ATP5E full-length ORF ( AAH01690, 1 a.a. - 51 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
31.35
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ATP5E
Entrez GeneID
514GeneBank Accession#
BC001690Protein Accession#
AAH01690Gene Name
ATP5E
Gene Alias
ATPE, MGC104243
Gene Description
ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
Omim ID
606153Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13. [provided by RefSeq
Other Designations
F(0)F(1)-ATPase|H(+)-transporting two-sector ATPase|OTTHUMP00000031404|OTTHUMP00000174442|OTTHUMP00000174443|mitochondrial ATP synthase epsilon chain|mitochondrial ATPase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com