ATP5E monoclonal antibody (M02), clone 1A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATP5E is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (31.35 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant ATP5E.
Immunogen
ATP5E (AAH01690, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.35 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATP5E is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — ATP5E
Entrez GeneID
514GeneBank Accession#
BC001690Protein Accession#
AAH01690Gene Name
ATP5E
Gene Alias
ATPE, MGC104243
Gene Description
ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
Omim ID
606153Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13. [provided by RefSeq
Other Designations
F(0)F(1)-ATPase|H(+)-transporting two-sector ATPase|OTTHUMP00000031404|OTTHUMP00000174442|OTTHUMP00000174443|mitochondrial ATP synthase epsilon chain|mitochondrial ATPase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com