ATP5E monoclonal antibody (M01), clone 2F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ATP5E.
Immunogen
ATP5E (AAH01690, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.35 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ATP5E monoclonal antibody (M01), clone 2F3 Western Blot analysis of ATP5E expression in SW-13 ( Cat # L005V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ATP5E on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — ATP5E
Entrez GeneID
514GeneBank Accession#
BC001690Protein Accession#
AAH01690Gene Name
ATP5E
Gene Alias
ATPE, MGC104243
Gene Description
ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
Omim ID
606153Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13. [provided by RefSeq
Other Designations
F(0)F(1)-ATPase|H(+)-transporting two-sector ATPase|OTTHUMP00000031404|OTTHUMP00000174442|OTTHUMP00000174443|mitochondrial ATP synthase epsilon chain|mitochondrial ATPase
-
Interactome
-
Pathway
-
Publication Reference
-
ATP Synthase Subunit Epsilon Overexpression Promotes Metastasis by Modulating AMPK Signaling to Induce Epithelial-to-Mesenchymal Transition and Is a Poor Prognostic Marker in Colorectal Cancer Patients.
Huang YJ, Jan YH, Chang YC, Tsai HF, Wu AT, Chen CL, Hsiao M.
Journal of Clinical Medicine 2019 Jul; 8(7):E1070.
Application:IHC-P, WB-Ce, WB-Tr, Human, CX-1, DLD-1, H3347, HCT-116, SW480, SW620 cells, Human colorectal cancer.
-
Assembly of human mitochondrial ATP synthase through two separate intermediates, F1-c-ring and b-e-g complex.
Fujikawa M, Sugawara K, Tanabe T, Yoshida M.
FEBS Letters 2015 Sep; 589(19 Pt):2707.
Application:WB, Human, HeLa cells.
-
Assessing actual contribution of IF1, inhibitor of mitochondrial FoF1, to ATP homeostasis, cell growth, mitochondrial morphology, and cell viability.
Fujikawa M, Imamura H, Nakamura J, Yoshida M.
The Journal of Biological Chemistry 2012 May; 287(22):18781.
Application:WB, Human, HeLa cells.
-
Mitochondrial ATP synthase deficiency due to a mutation in the ATP5E gene for the F1 {varepsilon} subunit.
Mayr JA, Havlickova V, Zimmermann F, Magler I, Kaplanova V, Jesina P, Pecinova A, Nuskova H, Koch J, Sperl W, Houstek J.
Human Molecular Genetics 2010 Sep; 19(17):3430.
Application:WB-Ce, Human, Human fibroblasts.
-
Knockdown of F(1) epsilon subunit decreases mitochondrial content of ATP synthase and leads to accumulation of subunit c.
Havlickova V, Kaplanova V, Nuskova H, Drahota Z, Houstek J.
Biochimica et Biophysica Acta 2010 Jun; 1797(6-7):1124.
Application:WB-Tr, Human, HEK 293 cells.
-
ATP Synthase Subunit Epsilon Overexpression Promotes Metastasis by Modulating AMPK Signaling to Induce Epithelial-to-Mesenchymal Transition and Is a Poor Prognostic Marker in Colorectal Cancer Patients.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com