Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP4B (Human) Recombinant Protein (P01)

  • Catalog # : H00000496-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ATP4B full-length ORF ( AAH29059, 1 a.a. - 291 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 57.75
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000496-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 496
  • Gene Name:
  • ATP4B
  • Gene Alias:
  • ATP6B
  • Gene Description:
  • ATPase, H+/K+ exchanging, beta polypeptide
  • Gene Summary:
  • The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. [provided by RefSeq
  • Other Designations:
  • ATPase, H+/K+ transporting, beta polypeptide,gastric H+/K+ ATPase beta subunit,gastric hydrogen-potassium ATPase, beta,hydrogen/potassium-exchanging ATPase 4B,potassium-transporting ATPase beta chain,proton pump beta chain
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook