Product Browser

Last updated: 2016/12/11
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP4B purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000496-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human ATP4B protein.
  • Immunogen:
  • ATP4B (AAH29059, 1 a.a. ~ 291 a.a) full-length human protein.
  • Sequence:
  • MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ATP4B MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP4B expression in human pancreas.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ATP4B MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP4B expression in mouse liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ATP4B expression in transfected 293T cell line (H00000496-T03) by ATP4B MaxPab polyclonal antibody.

    Lane 1: ATP4B transfected lysate(32.12 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 496
  • Gene Name:
  • ATP4B
  • Gene Alias:
  • ATP6B
  • Gene Description:
  • ATPase, H+/K+ exchanging, beta polypeptide
  • Gene Summary:
  • The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. [provided by RefSeq
  • Other Designations:
  • ATPase, H+/K+ transporting, beta polypeptide,gastric H+/K+ ATPase beta subunit,gastric hydrogen-potassium ATPase, beta,hydrogen/potassium-exchanging ATPase 4B,potassium-transporting ATPase beta chain,proton pump beta chain
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook