Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP2A3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000489-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ATP2A3 partial ORF ( AAH35729, 501 a.a. - 620 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.94
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000489-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 489
  • Gene Name:
  • ATP2A3
  • Gene Alias:
  • SERCA3
  • Gene Description:
  • ATPase, Ca++ transporting, ubiquitous
  • Gene Summary:
  • This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • ATPase, Ca(2+)-transporting, ubiquitous,SR Ca(2+)-ATPase 3,adenosine triphosphatase, calcium,calcium pump 3,calcium-translocating P-type ATPase,sarco/endoplasmic reticulum Ca2+ -ATPase,sarco/endoplasmic reticulum Ca2+ ATPase,sarcoplasmic/endoplasmic retic
  • RSS
  • YouTube
  • Linkedin
  • Facebook