ATP2A3 monoclonal antibody (M01), clone 2H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ATP2A3.
Immunogen
ATP2A3 (AAH35729, 501 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (88)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.94 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ATP2A3 monoclonal antibody (M01), clone 2H3 Western Blot analysis of ATP2A3 expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ATP2A3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATP2A3 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — ATP2A3
Entrez GeneID
489GeneBank Accession#
BC035729Protein Accession#
AAH35729Gene Name
ATP2A3
Gene Alias
SERCA3
Gene Description
ATPase, Ca++ transporting, ubiquitous
Omim ID
601929Gene Ontology
HyperlinkGene Summary
This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
ATPase, Ca(2+)-transporting, ubiquitous|SR Ca(2+)-ATPase 3|adenosine triphosphatase, calcium|calcium pump 3|calcium-translocating P-type ATPase|sarco/endoplasmic reticulum Ca2+ -ATPase|sarco/endoplasmic reticulum Ca2+ ATPase|sarcoplasmic/endoplasmic retic
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Sarco/endoplasmic reticulum calcium ATPase 3 (SERCA3) expression in gastrointestinal stromal tumours.
Homa Adle-Biassette, Riccardo Ricci, Antoine Martin, Maurizio Martini, Gloria Ravegnini, Rachid Kaci, Pascal Gélébart, Brigitte Poirot, Zsuzsanna Sándor, Jacqueline Lehman-Che, Erika Tóth, Bela Papp.
Pathology 2023 Dec; Epub.
Application:IHC, Human, Gastrointestinal stromal tumors.
-
Loss of endoplasmic reticulum calcium pump expression in choroid plexus tumours.
Ait-Ghezali L, Arbabian A, Jeibmann A, Hasselblatt M, Hallaert GG, Van den Broecke C, Gray F, Brouland JP, Varin-Blank N, Papp B.
Neuropathology and Applied Neurobiology 2014 Oct; 40(6):726.
Application:IHC, Human, Choroid plexus tissue.
-
Modulation of endoplasmic reticulum calcium pump expression during lung cancer cell differentiation.
Arbabian A, Brouland JP, Apáti Á, Pászty K, Hegedűs L, Enyedi Á, Chomienne C, Papp B.
The FEBS Journal 2013 Nov; 280(21):5408.
Application:IHC-P, Human, Lung.
-
Expression of Sarco/Endoplasmic Reticulum Ca2+ATPase (SERCA) 3 proteins in two major conformational states in native human cell membranes.
Corvazier E, Bredoux R, Kovacs T, Enouf J.
Biochimica et Biophysica Acta 2008 Dec; 1788(3):587.
Application:WB, Human , Human platelets, HEK 293 cells.
-
Sarco/endoplasmic reticulum calcium ATPase 3 (SERCA3) expression in gastrointestinal stromal tumours.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com