ATP2A1 monoclonal antibody (M01), clone 1B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ATP2A1 monoclonal antibody (M01), clone 1B11. Western Blot analysis of ATP2A1 expression in A-431 ( Cat # L015V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of ATP2A1 expression in transfected 293T cell line by ATP2A1 monoclonal antibody (M01), clone 1B11.
Lane 1: ATP2A1 transfected lysate(109.3 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ATP2A1 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATP2A1 is 0.03 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ATP2A1 on A-431 cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.75 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ATP2A1.
Immunogen
ATP2A1 (NP_775293, 522 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ATP2A1 monoclonal antibody (M01), clone 1B11. Western Blot analysis of ATP2A1 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ATP2A1 expression in transfected 293T cell line by ATP2A1 monoclonal antibody (M01), clone 1B11.
Lane 1: ATP2A1 transfected lysate(109.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ATP2A1 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATP2A1 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ATP2A1 on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — ATP2A1
Entrez GeneID
487GeneBank Accession#
NM_173201Protein Accession#
NP_775293Gene Name
ATP2A1
Gene Alias
ATP2A, SERCA1
Gene Description
ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
Gene Ontology
HyperlinkGene Summary
This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
ATPase, Ca++ transporting, fast twitch 1|OTTHUMP00000162562|SR Ca(2+)-ATPase 1|calcium pump 1|calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform|endoplasmic reticulum class 1/2 Ca(2+) ATPase|sarcoplasmic/endoplasm
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com