FXYD2 monoclonal antibody (M01), clone 1C3-B3

Catalog # H00000486-M01

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

FXYD2 monoclonal antibody (M01), clone 1C3-B3 Western Blot analysis of FXYD2 expression in Jurkat ( Cat # L017V1 ).

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunoperoxidase of monoclonal antibody to FXYD2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged FXYD2 is 0.3 ng/ml as a capture antibody.

QC Test

Western Blot detection against Immunogen (32.78 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a full length recombinant FXYD2.

    Immunogen

    FXYD2 (AAH05302.1, 1 a.a. ~ 64 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

    Host

    Mouse

    Reactivity

    Human

    Interspecies Antigen Sequence

    Rat (83)

    Isotype

    IgG2b kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (32.78 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    FXYD2 monoclonal antibody (M01), clone 1C3-B3 Western Blot analysis of FXYD2 expression in Jurkat ( Cat # L017V1 ).

    Western Blot (Recombinant protein)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunoperoxidase of monoclonal antibody to FXYD2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged FXYD2 is 0.3 ng/ml as a capture antibody.

    ELISA

  • Gene Info — FXYD2

    Entrez GeneID

    486

    GeneBank Accession#

    BC005302

    Protein Accession#

    AAH05302.1

    Gene Name

    FXYD2

    Gene Alias

    ATP1G1, HOMG2, MGC12372

    Gene Description

    FXYD domain containing ion transport regulator 2

    Omim ID

    154020 601814

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. The Type III integral membrane protein encoded by this gene is the gamma subunit of the Na,K-ATPase present on the plasma membrane. Although the Na,K-ATPase does not depend on the gamma subunit to be functional, it is thought that the gamma subunit modulates the enzyme's activity by inducing ion channel activity. Mutations in this gene have been associated with renal hypomagnesaemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

    Other Designations

    ATPase, Na+/K+ transporting, gamma 1 polypeptide|FXYD domain-containing ion transport regulator 2|Sodium-potassium-ATPase, gamma polypeptide|hypomagnesemia 2, renal

  • Interactome
  • Publication Reference
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All