Product Browser

Last updated: 2017/5/28
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP12A polyclonal antibody (A01)

  • Catalog # : H00000479-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ATP12A.
  • Immunogen:
  • ATP12A (NP_001667, 174 a.a. ~ 281 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SSFNKMIPQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIPADIRVLSSQGCRVDNSSLTGESEPQPRSSEFTHENPLETKNICFYSTTCLEASTSPVGTVTGMVIN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000479-A01
    Western Blot detection against Immunogen (37.99 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 479
  • Gene Name:
  • ATP12A
  • Gene Alias:
  • ATP1AL1
  • Gene Description:
  • ATPase, H+/K+ transporting, nongastric, alpha polypeptide
  • Gene Summary:
  • The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This gene encodes a catalytic subunit of the ouabain-sensitive H+/K+ -ATPase that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for potassium absorption in various tissues. [provided by RefSeq
  • Other Designations:
  • ATPase, Na+/K+ transporting, alpha polypeptide-like 1,ATPase, Na+K+ transporting, alpha-1 polypeptide-like,OTTHUMP00000018132,OTTHUMP00000042326,hydrogen/potassium-exchanging ATPase 12A,non-gastric H(+)/K(+) ATPase alpha subunit,potassium-transporting ATP
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook