ATOX1 monoclonal antibody (M06), clone 3F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ATOX1 monoclonal antibody (M06), clone 3F7. Western Blot analysis of ATOX1 expression in COLO 320 HSR ( Cat # L020V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATOX1 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.22 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ATOX1.
Immunogen
ATOX1 (NP_004036, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.22 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ATOX1 monoclonal antibody (M06), clone 3F7. Western Blot analysis of ATOX1 expression in COLO 320 HSR ( Cat # L020V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATOX1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — ATOX1
Entrez GeneID
475GeneBank Accession#
NM_004045Protein Accession#
NP_004036Gene Name
ATOX1
Gene Alias
ATX1, HAH1, MGC138453, MGC138455
Gene Description
ATX1 antioxidant protein 1 homolog (yeast)
Omim ID
602270Gene Ontology
HyperlinkGene Summary
This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq
Other Designations
antioxidant protein 1|copper transport protein|metal transport protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com