ATF3 monoclonal antibody (M01), clone 6B8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ATF3 expression in transfected 293T cell line by ATF3 monoclonal antibody (M01), clone 6B8.
Lane 1: ATF3 transfected lysate(20.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATF3 is approximately 1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of ATF3 over-expressed 293 cell line, cotransfected with ATF3 Validated Chimera RNAi ( Cat # H00000467-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ATF3 monoclonal antibody (M01), clone 6B8 (Cat # H00000467-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (45.65 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ATF3.
Immunogen
ATF3 (AAH06322, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (45.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ATF3 expression in transfected 293T cell line by ATF3 monoclonal antibody (M01), clone 6B8.
Lane 1: ATF3 transfected lysate(20.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATF3 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ATF3 over-expressed 293 cell line, cotransfected with ATF3 Validated Chimera RNAi ( Cat # H00000467-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ATF3 monoclonal antibody (M01), clone 6B8 (Cat # H00000467-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — ATF3
Entrez GeneID
467GeneBank Accession#
BC006322Protein Accession#
AAH06322Gene Name
ATF3
Gene Alias
-
Gene Description
activating transcription factor 3
Omim ID
603148Gene Ontology
HyperlinkGene Summary
Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes. [provided by RefSeq
Other Designations
ATF3deltaZip2|ATF3deltaZip2c|ATF3deltaZip3|OTTHUMP00000034887|OTTHUMP00000034890
-
Interactome
-
Disease
-
Publication Reference
-
Transcriptional regulators of the ΔNp63: their role in limbal epithelial cell proliferation.
Hsueh YJ, Kuo PC, Chen JK.
Journal of Cellular Physiology 2013 Mar; 228(3):536.
Application：WB-Ti, Rabbit, Cornea, Limbus.
-
Steroids and extracellular signal-regulated kinase 1/2 activity suppress activating transcription factor 3 expression in patients with severe asthma.
Roussel L, Robins S, Schachter A, Berube J, Hamid Q, Rousseau S.
J Allergy Clin Immunol 2011 Apr; 127:1632.
Application：IHC, Human, Bronchoscopic.
-
Energy restriction-mimetic agents induce apoptosis in prostate cancer cells, in part, through epigenetic activation of KLF6 tumor suppressor gene expression.
Chen CH, Huang PH, Chu PC, Chen MC, Chou CC, Wang D, Kulp SK, Teng CM, Wang Q, Chen CS.
The Journal of Biological Chemistry 2011 Mar; 286(12):9968.
Application：WB, Human, LNCaP cells.
-
Transcriptional regulators of the ΔNp63: their role in limbal epithelial cell proliferation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com