Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ASPA purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000443-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human ASPA protein.
  • Immunogen:
  • ASPA (NP_000040.1, 1 a.a. ~ 313 a.a) full-length human protein.
  • Sequence:
  • MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ASPA MaxPab rabbit polyclonal antibody. Western Blot analysis of ASPA expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ASPA MaxPab rabbit polyclonal antibody. Western Blot analysis of ASPA expression in mouse liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ASPA expression in transfected 293T cell line (H00000443-T01) by ASPA MaxPab polyclonal antibody.

    Lane 1: ASPA transfected lysate(35.70 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 443
  • Gene Name:
  • ASPA
  • Gene Alias:
  • ACY2,ASP
  • Gene Description:
  • aspartoacylase (Canavan disease)
  • Gene Summary:
  • This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
  • Other Designations:
  • aminoacylase 2,aspartoacylase
  • RSS
  • YouTube
  • Linkedin
  • Facebook