Product Browser

Last updated: 2020/11/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ASGR1 monoclonal antibody (M01), clone 1E12 

  • Catalog # : H00000432-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against human ASGR1.
  • Immunogen:
  • A synthetic peptide corresponding to human ASGR1
  • Sequence:
  • GRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ASGR1 monoclonal antibody (M01), clone 1E12. Western Blot analysis of ASGR1 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ASGR1 monoclonal antibody (M01), clone 1E12. Western Blot analysis of ASGR1 expression in HepG2.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 432
  • Gene Name:
  • ASGR1
  • Gene Alias:
  • HL-1,ASGPR,ASGPR1,CLEC4H1
  • Gene Description:
  • asialoglycoprotein receptor 1
  • Gene Summary:
  • Partially deglycosylated plasma glycoproteins and immunoglobulin IgA2 allotypes are efficiently and specifically removed from circulation by a receptor-mediated process. The asialoglycoprotein receptor binds to desialylated (galactosyl-terminal) glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociate. Then the receptor is recycled back to the cell surface and the ligand is transported to the lysosomes for degradation. [provided by RefSeq
  • Other Designations:
  • C-type lectin domain family 4, member H1,hepatic lectin H1
  • RSS
  • YouTube
  • Linkedin
  • Facebook